Skip to main content

Advertisement

Table 3 List of predicted effector candidates carrying the RxLx[EDQ] motif

From: Genome sequence of the potato pathogenic fungus Alternaria solani HWC-168 reveals clues for its conidiation and virulence

Name Size Start of sequence
ASLO_253 148 MKFTLAIVALASVATTALANREWTYNDSHRAAVTAILKQITAKHAHLCKR
ASLO_323 134 MKLAIAALFASITAAAPTATPDVHGDPFETVTISNFVYVGVNGYPQIDFH
ASLO_2101 114 MQIMNLAVLAATLATVGAWTLDDYGKWVANNAWRDNLNGVHKVHESCAER
ASLO_4082 266 MKFLAIIVAAQLATALPVAKEACSSTDITCSATKANPQIFDVASQQLDNS
ASLO_5583 205 MVSFRNLFTAAMALSVPVAAVLTPAQIVDNIRILTQKSQALQAPAQSITI
ASLO_5663 199 MASSIPDHWLWLGLGVFTFIAVQQVSHGLHTIRALTEIRNPQNMPQQRRA
ASLO_6610 169 MLGRTVFAATFFALAQFAMASPPSCLLGAVNQYEDPSDIKAVCKARNLSE
ASLO_6668 183 MFLPTALLALVHLALPALSHASPQPALVSSDWEMSLVPRHQLFLRQLSDL
ASLO_8389 252 MYSKTAIVTFFAGFAAAQIHAPVGEPSGNPITRPLNEVVPTCEQFTITWQ
ASLO_8909 270 MAKLIDLSTEVLFLIVAYFTSGDASDVQALLHLCRTSRMLVAVAQPALYT
ASLO_9385 163 MHFSVIFSAVFAATAMAAPASLDSRGDEDCVPDSYTISDYTLITSPTSGS
ASLO_10144 244 MLSNLMNRFALPLAILAFFLSFANGLPHDALIARRTTNLRILPLGDSITW