Skip to main content

Table 2 Protein coding sequences exhibiting Tat-type signal sequences in C. glutamicum

From: Corynebacterium glutamicum possesses β-N-acetylglucosaminidase

Protein ID, locus tag Annotation Signal sequencea Length (aa) Secretion pathway
Cg0955, cg0955 secreted protein MQINRRGFLKATTGLATIGAASMFMPKANA/LG 30 TAT
PS2, cgR_2070 S-layer protein MGKHRRNNSNATRKAVAASAVALGATAAIASPAQA/AE 35 Sec
PhoD, cg2485 alkaline Phosphatase MPQLSRRQFLQTTAVTAGLATFAGTPARA/EE 29 TAT
Cmt4, cg2394 corynomycolyl transferase MRKGISRVLSVAVASSIGFGTVLTGTGIAAA/QD 31 Sec
Cmt1, cg0413 trehalose corynomycolyl transferase MKLLRRIAAPAIALGIAMSTIVTPSTAGA/AE 29 Sec
  1. aThe amino acids residues in bold indicate residues involved in signal peptide cleavage and the putative cleavage site is marked by a solidus (/)