Skip to main content

Table 1 Identification of putative C. difficile SrtB substrates in strain 630

From: Clostridium difficilehas a single sortase, SrtB, that can be inhibited by small-molecule inhibitors

Protein Function C-terminal sorting signal
CD630_01830 Putative cell wall hydrolase MIHSPSTGKTVSVTSINSSYYTARFVTA KRIL
CD630_03860 Putative cell surface protein, collagen binding protein PSDSPKTGDNTNLYGLLALLLTSGAGLAGIFFY KRRKMKKS
CD630_25370 Putative membrane-associated 5'-nucleotidase/phosphoesterase KEKSPKTGDLGFSNSIIIFIVSSTLICLLNFNQKELKDKKSK
CD630_27680 Putative cell-wall hydrolase FIHSPQTGDVVKVTSMAPGTNYA RRLITATRVLQ
CD630_28310 Putative adhesion, collagen binding protein PPVPPKTGDSTTIIGEILLVIGAIVGLIVL RRNKNTN
CD630_31450 Collagen binding protein, CbpA VGQNVQTGDQSNIMLDLALMFISLFFLI KNLTNKYLRRK
CD630_32460 Putative surface protein IVKSPKTGDETQLMSYVFISVIAICGLAYQCKIKRN
CD630_33920 Putative cell surface protein, collagen binding protein PSDSPKTGDSTNLMAFIVMLLVSGGGLAGTYLY KRRKMKKS
  1. Bold = predicted sortase recognition sequence.
  2. Bold and Italic = hydrophobic residues.
  3. Italics only = positively charged residues.