Skip to main content

Table 1 Amino acid sequence and pI values of Hlp synthetic peptides. Basic amino acids are in bold.

From: Characterization of two heparan sulphate-binding sites in the mycobacterial adhesin Hlp

Peptide Amino acid sequence pI
p1 1MNKAELIDVLTQKLGSDRRQATAAVENVVD30 5.00
p2 16SDRRQATAAVENVVDTIVRAVHKGDSVTIT45 6.48
p3 31TIVRAVHKGDSVTITGFGVFEQRRRAARVA60 11.83
p4 46GFGVFEQRRRAARVARNPRTGETVKVKPTS75 12.01
p5 61RNPRTGETVKVKPTSVPAFRPGAQFKAVVA90 11.73
p6 76VPAFRPGAQFKAVVAGAQRLPLEGPAVKRG105 11.72
p7 91GAQRLPLEGPAVKRGVATSAAKKAAIKKAP120 11.22
p8 106VATSAAKKAAIKKAPVKKALAKKAATKAPA135 10.90
p9 121VKKALAKKAATKAPAKKAVKAPAKKITTAV150 10.95
p10 136KKAVKAPAKKITTAVKVPAKKATKVVKKVA165 11.00
p11 151KVPAKKATKVVKKVAAKAPVRKATTRALAK180 10.70
p12 166AKAPVRKATTRALAKKAAVKKAPAKKVTAA195 12.06
p13 181KAAVKKAPAKKVTAAKRGRK200 12.05