Skip to main content

Table 1 The C-terminal part of deduced cyanobacterial hydrogenase large subunit amino acid sequences. Cyanobacterial sequences in the focus of this study are shown in bold. The accession number and the C-terminal protein sequence follow the gene name. The putative cutting site is represented by a gap. As reference, the cutting sites of Escherichia coli hydrogenase large subunits are shown. Corresponding GenBank accession numbers are indicated. The consensus sequence D(P/S)CxxCxx(H/R) is shown in italic letters.

From: Presence and expression of hydrogenase specific C-terminal endopeptidases in cyanobacteria

Synechocystis PCC 6803
HoxH CAA66212.1 -NRVEAGIRCYDPCLSCSTH AAGQMPLMIDLVNPQGELIKSIQRD
Nostoc ATCC 29133
HupL AAC16277.1 -VEVGHVARSFDSCLVCTVH AHDAKTGEELARFRTA
Anabaena PCC 7120    
HupL AAC79878.1 -VEVGHVARSFDSCLVCTVH AHDAKTGEELARFRTA
HoxH NP_484809 -NRVEAGIRAFDPCLSCSTH AAGQMPLHIQLVAADGNIVNQVWRE
Anabaena variabilis
HupL CAA73659.2 -VEVGHVARSFDSCLVCTVH AHDAKTGEELARFRTA
HoxH CAA55878.1 -NRVEAGIRAFDPCLSCSTH AAGQMPLHIQLVAANGNIVNQVWREKLGV
Synechococcus PCC 6301
HoxH CAA66383.1 -NRVEAGIRCFDPCLSCSTH TAGQMPLKIEIFDSRGELYQCLCRDL
Prochlorothrix hollandica
HoxH AAB53705.1 -NRVEAGIPCYDPCLSCSTH AAAKCPSMWNWWVPTAPLSRKRCGLGQRVPRF
Escherichia coli
HyaB AAA23998.1 -LEILRTLHSFDPCLACSTH VLGDDGSELISVQVR
HybC AAA21591.1 -LEVVRTIHSFDPCMACAVH VVDADGNEVVSVKVL
HycE CAA35550.1 -SDAPLIIGSLDPCYSCTDR MTVVDVRKKKSKVVPYKELERYSIERKNSPLK