Skip to main content

Table 1 Peptide Cleavage Products for BoNT/B and/G.

From: A historical and proteomic analysis of botulinum neurotoxin type/G

  BoNT/B and/G Substrate Masses
Intact LSELDDRADALQAGASQFESAAKLKRKYWWKNLK 4025
/B-NT LSELDDRADALQAGASQ   1759
/B-CT   FESAAKLKRKYWWKNLK 2283
/G-NT LSELDDRADALQAGASQFESA   2281
/G-CT   AKLKRKYWWKNLK 1762
  1. The predicted cleavage products and the masses of the substrate and product peptides for both/B and/G are shown. The substrate peptide was derived from the human Synaptobrevin-2 (VAMP-2) protein. Note that/B and/G cleave 4 amino acids apart.